Μεταλλαγμένος SARS coronavirus Urbani κλώνος SARS-Urbani-MA_SHCO14-spike, το πλήρες γονιδίωμα

NOTICE

Μεταλλαγμένος SARS coronavirus Urbani κλώνοςSARS-Urbani-MA_SHCO14-spike, το πλήρες γονιδίωμα

Since 2004, there have not been any
known cases of SARS reported anywhere
in the world. The content in this PDF was
developed for the 2003 SARS epidemic.
But, some guidelines are still being
used. Any new SARS updates will be
posted on this Web site.
AY278741 29727 bp RNA linear VRL 21-APR-2003

LOCUS
DEFINITION SARS coronavirus Urbani, complete genome.

ACCESSION AY278741

VERSION AY278741.1 GI:30027617

KEYWORDS .

SOURCE SARS coronavirus Urbani

ORGANISM SARS coronavirus Urbani

Viruses; ssRNA positive-strand viruses, no DNA stage; Nidovirales;

Coronaviridae; Coronavirus.

REFERENCE 1 (bases 1 to 29727)

AUTHORS Monroe,S.S.

CONSRTM CDC SARS Coronavirus Sequencing Team

TITLE SARS coronavirus (SARS-CoV), Urbani strain

JOURNAL Unpublished (2003)

REFERENCE 2 (bases 1 to 29727)

AUTHORS Bellini,W.J., Campagnoli,R.P., Icenogle,J.P., Monroe,S.S.,

Nix,W.A., Oberste,M.S., Pallansch,M.A. and Rota,P.A.

TITLE Direct Submission

JOURNAL Submitted (17-APR-2003) Division of Viral and Rickettsial Diseases,

Centers for Disease Control and Prevention, 1600 Clifton RD, NE,

Atlanta, GA 30333, USA

FEATURES Location/Qualifiers

source 1..29727

/organism=”SARS coronavirus Urbani”

/mol_type=”genomic RNA”

/strain=”Urbani”

/db_xref=”taxon:228330″

/cell_line=”Vero”

5’UTR 1..264

CDS join(265..13398,13398..21485)

/note=”ORF 1ab; ribosomal slippage”

/codon_start=1

/product=”nonstructural polyprotein pp1ab”

/protein_id=”AAP13442.1″

/db_xref=”GI:30027621″

/translation=”MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEARE

HLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGI

TLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQN

WNTKHGSGALRELTRELNGGAVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQ

LDYIESKRGVYCCRDHEHEIAWFTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFP

LNSKVKVIQPRVEKKKTEGFMGRIRSVYPVASPQECNNMHLSTLMKCNHCDEVSWQTC

DFLKATCEHCGTENLVIEGPTTCGYLPTNAVVKMPCPACQDPEIGPEHSVADYHNHSN

IETRLRKGGRTRCFGGCVFAYVGCYNKRAYWVPRASADIGSGHTGITGDNVETLNEDL

LEILSRERVNINIVGDFHLNEEVAIILASFSASTSAFIDTIKSLDYKSFKTIVESCGN

YKVTKGKPVKGAWNIGQQRSVLTPLCGFPSQAAGVIRSIFARTLDAANHSIPDLQRAA

VTILDGISEQSLRLVDAMVYTSDLLTNSVIIMAYVTGGLVQQTSQWLSNLLGTTVEKL

RPIFEWIEAKLSAGVEFLKDAWEILKFLITGVFDIVKGQIQVASDNIKDCVKCFIDVV

NKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQCIRGKEQLQLLMPLKAPKEVT

FLEGDSHDTVLTSEEVVLKNGELEALETPVDSFTNGAIVGTPVCVNGLMLLEIKDKEQ

YCALSPGLLATNNVFRLKGGAPIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNE

KCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGE

ENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGLPLEFGASAETVR

VEEEEEEDWLDDTTEQSEIEPEPEPTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSA

NPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNL

AKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQT

VRTQVYIAVNDKALYEQVVMDYLDNLKPRVEAPKQEEPPNTEDSKTEEKSVVQKPVDV

KPKIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYM

VGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKT

ALKKCKSAFYVLPSEAPNAKEEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATI

QRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLE

EAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSSSKTSEEHFVETVSLAGSYRDWSYSG

QRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLSLREVKTIKVFTTVD

NTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFE

YYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQLEVKFN

APALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLN

VVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMM

SAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTD

VFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPIDLVPTQPLPNA

SFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYRHYSASFKK

GAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVEDTQGMDNL

ACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHEDLMA

AYVENTSITIKKPNELSLALGLKTIATHGIAAINSVPWSKILAYVKPFLGQAAITTSN

CAKRLAQRVFNNYMPYVFTLLFQLCTFTKSTNSRIRASLPTTIAKNSVKSVAKLCLDA

GINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYCNGVRELYL

NSSNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVL

AYMLFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFF

ASFYYIWKSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGMKRSFYVYANGGRGFC

KTHNWNCLNCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHL

YFDKAGQKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYY

SQLMCQPILLLDQVLVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSE

LAKGVALDGVLSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTY

NKVENMTPRDLGACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSEQLRKQIRSAAKK

NNIPFRLTCATTRQVVNVITTKISLKGGKIVSTCFKLMLKATLLCVLAALVCYIVMPV

HTLSIHDGYTNEIIGYKAIQDGVTRDIISTDDCFANKHAGFDAWFSQRGGSYKNDKSC

PVVAAIITREIGFIVPGLPGTVLRAINGDFLHFLPRVFSAVGNICYTPSKLIEYSDFA

TSACVLAAECTIFKDAMGKPVPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNT

YLEGSVRVVTTFDAEYCRHGTCERSEVGICLSTSGRWVLNNEHYRALSGVFCGVDAMN

LIANIFTPLVQPVGALDVSASVVAGGIIAILVTCAAYYFMKFRRVFGEYNHVVAANAL

LFLMSFTILCLVPAYSFLPGVYSVFYLYLTFYFTNDVSFLAHLQWFAMFSPIVPFWIT

AIYVFCISLKHCHWFFNNYLRKRVMFNGVTFSTFEEAALCTFLLNKEMYLKLRSETLL

PLTQYNRYLALYNKYKYFSGALDTTSYREAACCHLAKALNDFSNSGADVLYQPPQTSI

TSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNP

NYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQ

TFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELP

TGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTT

LNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGS

TILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFF

VYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRI

MTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKV

YYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCI

MLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDA

FKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLH

NDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCEEMLDNRATLQAIASEFSSLPS

YAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQ

MYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAK

LMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLI

VTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALL

SDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVL

GSLAATVRLQAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTH

TGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCAND

PVGFTLRNTVCTVCGMWKGYGCSCDQLREPLMQSADASTFLNRVCGVSAARLTPCGTG

TSTDVVYRAFDIYNEKVAGFAKFLKTNCCRFQEKDEEGNLLDSYFVVKRHTMSNYQHE

ETIYNLVKDCPAVAVHDFFKFRVDGDMVPHISRQRLTKYTMADLVYALRHFDEGNCDT

LKEILVTYNCCDDDYFNKKDWYDFVENPDILRVYANLGERVRQSLLKTVQFCDAMRDA

GIVGVLTLDNQDLNGNWYDFGDFVQVAPGCGVPIVDSYYSLLMPILTLTRALAAESHM

DADLAKPLIKWDLLKYDFTEERLCLFDRYFKYWDQTYHPNCINCLDDRCILHCANFNV

LFSTVFPPTSFGPLVRKIFVDGVPFVVSTGYHFRELGVVHNQDVNLHSSRLSFKELLV

YAADPAMHAASGNLLLDKRTTCFSVAALTNNVAFQTVKPGNFNKDFYDFAVSKGFFKE

GSSVELKHFFFAQDGNAAISDYDYYRYNLPTMCDIRQLLFVVEVVDKYFDCYDGGCIN

ANQVIVNNLDKSAGFPFNKWGKARLYYDSMSYEDQDALFAYTKRNVIPTITQMNLKYA

ISAKNRARTVAGVSICSTMTNRQFHQKLLKSIAATRGATVVIGTSKFYGGWHNMLKTV

YSDVETPHLMGWDYPKCDRAMPNMLRIMASLVLARKHNTCCNLSHRFYRLANECAQVL

SEMVMCGGSLYVKPGGTSSGDATTAYANSVFNICQAVTANVNALLSTDGNKIADKYVR

NLQHRLYECLYRNRDVDHEFVDEFYAYLRKHFSMMILSDDAVVCYNSNYAAQGLVASI

KNFKAVLYYQNNVFMSEAKCWTETDLTKGPHEFCSQHTMLVKQGDDYVYLPYPDPSRI

LGAGCFVDDIVKTDGTLMIERFVSLAIDAYPLTKHPNQEYADVFHLYLQYIRKLHDEL

TGHMLDMYSVMLTNDNTSRYWEPEFYEAMYTPHTVLQAVGACVLCNSQTSLRCGACIR

RPFLCCKCCYDHVISTSHKLVLSVNPYVCNAPGCDVTDVTQLYLGGMSYYCKSHKPPI

SFPLCANGQVFGLYKNTCVGSDNVTDFNAIATCDWTNAGDYILANTCTERLKLFAAET

LKATEETFKLSYGIATVREVLSDRELHLSWEVGKPRPPLNRNYVFTGYRVTKNSKVQI

GEYTFEKGDYGDAVVYRGTTTYKLNVGDYFVLTSHTVMPLSAPTLVPQEHYVRITGLY

PTLNISDEFSSNVANYQKVGMQKYSTLQGPPGTGKSHFAIGLALYYPSARIVYTACSH

AAVDALCEKALKYLPIDKCSRIIPARARVECFDKFKVNSTLEQYVFCTVNALPETTAD

IVVFDEISMATNYDLSVVNARLRAKHYVYIGDPAQLPAPRTLLTKGTLEPEYFNSVCR

LMKTIGPDMFLGTCRRCPAEIVDTVSALVYDNKLKAHKDKSAQCFKMFYKGVITHDVS

SAINRPQIGVVREFLTRNPAWRKAVFISPYNSQNAVASKILGLPTQTVDSSQGSEYDY

VIFTQTTETAHSCNVNRFNVAITRAKIGILCIMSDRDLYDKLQFTSLEIPRRNVATLQ

AENVTGLFKDCSKIITGLHPTQAPTHLSVDIKFKTEGLCVDIPGIPKDMTYRRLISMM

GFKMNYQVNGYPNMFITREEAIRHVRAWIGFDVEGCHATRDAVGTNLPLQLGFSTGVN

LVAVPTGYVDTENNTEFTRVNAKPPPGDQFKHLIPLMYKGLPWNVVRIKIVQMLSDTL

KGLSDRVVFVLWAHGFELTSMKYFVKIGPERTCCLCDKRATCFSTSSDTYACWNHSVG

FDYVYNPFMIDVQQWGFTGNLQSNHDQHCQVHGNAHVASCDAIMTRCLAVHECFVKRV

DWSVEYPIIGDELRVNSACRKVQHMVVKSALLADKFPVLHDIGNPKAIKCVPQAEVEW

KFYDAQPCSDKAYKIEELFYSYATHHDKFTDGVCLFWNCNVDRYPANAIVCRFDTRVL

SNLNLPGCDGGSLYVNKHAFHTPAFDKSAFTNLKQLPFFYYSDSPCESHGKQVVSDID

YVPLKSATCITRCNLGGAVCRHHANEYRQYLDAYNMMISAGFSLWIYKQFDTYNLWNT

FTRLQSLENVAYNVVNKGHFDGHAGEAPVSIINNAVYTKVDGIDVEIFENKTTLPVNV

AFELWAKRNIKPVPEIKILNNLGVDIAANTVIWDYKREAPAHVSTIGVCTMTDIAKKP

TESACSSLTVLFDGRVEGQVDLFRNARNGVLITEGSVKGLTPSKGPAQASVNGVTLIG

ESVKTQFNYFKKVDGIIQQLPETYFTQSRDLEDFKPRSQMETDFLELAMDEFIQRYKL

EGYAFEHIVYGDFSHGQLGGLHLMIGLAKRSQDSPLKLEDFIPMDSTVKNYFITDAQT

GSSKCVCSVIDLLLDDFVEIIKSQDLSVISKVVKVTIDYAEISFMLWCKDGHVETFYP

KLQASQAWQPGVAMPNLYKMQRMLLEKCDLQNYGENAVIPKGIMMNVAKYTQLCQYLN

TLTLAVPYNMRVIHFGAGSDKGVAPGTAVLRQWLPTGTLLVDSDLNDFVSDADSTLIG

DCATVHTANKWDLIISDMYDPRTKHVTKENDSKEGFFTYLCGFIKQKLALGGSIAVKI

TEHSWNADLYKLMGHFSWWTAFVTNVNASSSEAFLIGANYLGKPKEQIDGYTMHANYI

FWRNTNPIQLSSYSLFDMSKFPLKLRGTAVMSLKENQINDMIYSLLEKGRLIIRENNR

VVVSSDILVNN”

CDS 265..13413

/note=”ORF 1a”

/codon_start=1

/product=”nonstructural polyprotein pp1a”

/protein_id=”AAP13439.1″

/db_xref=”GI:30027618″

/translation=”MESLVLGVNEKTHVQLSLPVLQVRDVLVRGFGDSVEEALSEARE

HLKNGTCGLVELEKGVLPQLEQPYVFIKRSDALSTNHGHKVVELVAEMDGIQYGRSGI

TLGVLVPHVGETPIAYRNVLLRKNGNKGAGGHSYGIDLKSYDLGDELGTDPIEDYEQN

WNTKHGSGALRELTRELNGGAVTRYVDNNFCGPDGYPLDCIKDFLARAGKSMCTLSEQ

LDYIESKRGVYCCRDHEHEIAWFTERSDKSYEHQTPFEIKSAKKFDTFKGECPKFVFP

LNSKVKVIQPRVEKKKTEGFMGRIRSVYPVASPQECNNMHLSTLMKCNHCDEVSWQTC

DFLKATCEHCGTENLVIEGPTTCGYLPTNAVVKMPCPACQDPEIGPEHSVADYHNHSN

IETRLRKGGRTRCFGGCVFAYVGCYNKRAYWVPRASADIGSGHTGITGDNVETLNEDL

LEILSRERVNINIVGDFHLNEEVAIILASFSASTSAFIDTIKSLDYKSFKTIVESCGN

YKVTKGKPVKGAWNIGQQRSVLTPLCGFPSQAAGVIRSIFARTLDAANHSIPDLQRAA

VTILDGISEQSLRLVDAMVYTSDLLTNSVIIMAYVTGGLVQQTSQWLSNLLGTTVEKL

RPIFEWIEAKLSAGVEFLKDAWEILKFLITGVFDIVKGQIQVASDNIKDCVKCFIDVV

NKALEMCIDQVTIAGAKLRSLNLGEVFIAQSKGLYRQCIRGKEQLQLLMPLKAPKEVT

FLEGDSHDTVLTSEEVVLKNGELEALETPVDSFTNGAIVGTPVCVNGLMLLEIKDKEQ

YCALSPGLLATNNVFRLKGGAPIKGVTFGEDTVWEVQGYKNVRITFELDERVDKVLNE

KCSVYTVESGTEVTEFACVVAEAVVKTLQPVSDLLTNMGIDLDEWSVATFYLFDDAGE

ENFSSRMYCSFYPPDEEEEDDAECEEEEIDETCEHEYGTEDDYQGLPLEFGASAETVR

VEEEEEEDWLDDTTEQSEIEPEPEPTPEEPVNQFTGYLKLTDNVAIKCVDIVKEAQSA

NPMVIVNAANIHLKHGGGVAGALNKATNGAMQKESDDYIKLNGPLTVGGSCLLSGHNL

AKKCLHVVGPNLNAGEDIQLLKAAYENFNSQDILLAPLLSAGIFGAKPLQSLQVCVQT

VRTQVYIAVNDKALYEQVVMDYLDNLKPRVEAPKQEEPPNTEDSKTEEKSVVQKPVDV

KPKIKACIDEVTTTLEETKFLTNKLLLFADINGKLYHDSQNMLRGEDMSFLEKDAPYM

VGDVITSGDITCVVIPSKKAGGTTEMLSRALKKVPVDEYITTYPGQGCAGYTLEEAKT

ALKKCKSAFYVLPSEAPNAKEEILGTVSWNLREMLAHAEETRKLMPICMDVRAIMATI

QRKYKGIKIQEGIVDYGVRFFFYTSKEPVASIITKLNSLNEPLVTMPIGYVTHGFNLE

EAARCMRSLKAPAVVSVSSPDAVTTYNGYLTSSSKTSEEHFVETVSLAGSYRDWSYSG

QRTELGVEFLKRGDKIVYHTLESPVEFHLDGEVLSLDKLKSLLSLREVKTIKVFTTVD

NTNLHTQLVDMSMTYGQQFGPTYLDGADVTKIKPHVNHEGKTFFVLPSDDTLRSEAFE

YYHTLDESFLGRYMSALNHTKKWKFPQVGGLTSIKWADNNCYLSSVLLALQQLEVKFN

APALQEAYYRARAGDAANFCALILAYSNKTVGELGDVRETMTHLLQHANLESAKRVLN

VVCKHCGQKTTTLTGVEAVMYMGTLSYDNLKTGVSIPCVCGRDATQYLVQQESSFVMM

SAPPAEYKLQQGTFLCANEYTGNYQCGHYTHITAKETLYRIDGAHLTKMSEYKGPVTD

VFYKETSYTTTIKPVSYKLDGVTYTEIEPKLDGYYKKDNAYYTEQPIDLVPTQPLPNA

SFDNFKLTCSNTKFADDLNQMTGFTKPASRELSVTFFPDLNGDVVAIDYRHYSASFKK

GAKLLHKPIVWHINQATTKTTFKPNTWCLRCLWSTKPVDTSNSFEVLAVEDTQGMDNL

ACESQQPTSEEVVENPTIQKEVIECDVKTTEVVGNVILKPSDEGVKVTQELGHEDLMA

AYVENTSITIKKPNELSLALGLKTIATHGIAAINSVPWSKILAYVKPFLGQAAITTSN

CAKRLAQRVFNNYMPYVFTLLFQLCTFTKSTNSRIRASLPTTIAKNSVKSVAKLCLDA

GINYVKSPKFSKLFTIAMWLLLLSICLGSLICVTAAFGVLLSNFGAPSYCNGVRELYL

NSSNVTTMDFCEGSFPCSICLSGLDSLDSYPALETIQVTISSYKLDLTILGLAAEWVL

AYMLFTKFFYLLGLSAIMQVFFGYFASHFISNSWLMWFIISIVQMAPVSAMVRMYIFF

ASFYYIWKSYVHIMDGCTSSTCMMCYKRNRATRVECTTIVNGMKRSFYVYANGGRGFC

KTHNWNCLNCDTFCTGSTFISDEVARDLSLQFKRPINPTDQSSYIVDSVAVKNGALHL

YFDKAGQKTYERHPLSHFVNLDNLRANNTKGSLPINVIVFDGKSKCDESASKSASVYY

SQLMCQPILLLDQVLVSDVGDSTEVSVKMFDAYVDTFSATFSVPMEKLKALVATAHSE

LAKGVALDGVLSTFVSAARQGVVDTDVDTKDVIECLKLSHHSDLEVTGDSCNNFMLTY

NKVENMTPRDLGACIDCNARHINAQVAKSHNVSLIWNVKDYMSLSEQLRKQIRSAAKK

NNIPFRLTCATTRQVVNVITTKISLKGGKIVSTCFKLMLKATLLCVLAALVCYIVMPV

HTLSIHDGYTNEIIGYKAIQDGVTRDIISTDDCFANKHAGFDAWFSQRGGSYKNDKSC

PVVAAIITREIGFIVPGLPGTVLRAINGDFLHFLPRVFSAVGNICYTPSKLIEYSDFA

TSACVLAAECTIFKDAMGKPVPYCYDTNLLEGSISYSELRPDTRYVLMDGSIIQFPNT

YLEGSVRVVTTFDAEYCRHGTCERSEVGICLSTSGRWVLNNEHYRALSGVFCGVDAMN

LIANIFTPLVQPVGALDVSASVVAGGIIAILVTCAAYYFMKFRRVFGEYNHVVAANAL

LFLMSFTILCLVPAYSFLPGVYSVFYLYLTFYFTNDVSFLAHLQWFAMFSPIVPFWIT

AIYVFCISLKHCHWFFNNYLRKRVMFNGVTFSTFEEAALCTFLLNKEMYLKLRSETLL

PLTQYNRYLALYNKYKYFSGALDTTSYREAACCHLAKALNDFSNSGADVLYQPPQTSI

TSAVLQSGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDTVYCPRHVICTAEDMLNP

NYEDLLIRKSNHSFLVQAGNVQLRVIGHSMQNCLLRLKVDTSNPKTPKYKFVRIQPGQ

TFSVLACYNGSPSGVYQCAMRPNHTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELP

TGVHAGTDLEGKFYGPFVDRQTAQAAGTDTTITLNVLAWLYAAVINGDRWFLNRFTTT

LNDFNLVAMKYNYEPLTQDHVDILGPLSAQTGIAVLDMCAALKELLQNGMNGRTILGS

TILEDEFTPFDVVRQCSGVTFQGKFKKIVKGTHHWMLLTFLTSLLILVQSTQWSLFFF

VYENAFLPFTLGIMAIAACAMLLVKHKHAFLCLFLLPSLATVAYFNMVYMPASWVMRI

MTWLELADTSLSGYRLKDCVMYASALVLLILMTARTVYDDAARRVWTLMNVITLVYKV

YYGNALDQAISMWALVISVTSNYSGVVTTIMFLARAIVFVCVEYYPLLFITGNTLQCI

MLVYCFLGYCCCCYFGLFCLLNRYFRLTLGVYDYLVSTQEFRYMNSQGLLPPKSSIDA

FKLNIKLLGIGGKPCIKVATVQSKMSDVKCTSVVLLSVLQQLRVESSSKLWAQCVQLH

NDILLAKDTTEAFEKMVSLLSVLLSMQGAVDINRLCEEMLDNRATLQAIASEFSSLPS

YAAYATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQ

MYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAK

LMVVVPDYGTYKNTCDGNTFTYASALWEIQQVVDADSKIVQLSEINMDNSPNLAWPLI

VTALRANSAVKLQNNELSPVALRQMSCAAGTTQTACTDDNALAYYNNSKGGRFVLALL

SDHQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVL

GSLAATVRLQAGNATEVPANSTVLSFCAFAVDPAKAYKDYLASGGQPITNCVKMLCTH

TGTGQAITVTPEANMDQESFGGASCCLYCRCHIDHPNPKGFCDLKGKYVQIPTTCAND

PVGFTLRNTVCTVCGMWKGYGCSCDQLREPLMQSADASTFLNGFAV”

CDS <13398..21485

/note=”ORF 1b; expressed via predicted -1 ribosomal

frameshift”

/codon_start=1

/product=”nonstructural polyprotein”

/protein_id=”AAP13440.1″

/db_xref=”GI:30027619″

/translation=”RVCGVSAARLTPCGTGTSTDVVYRAFDIYNEKVAGFAKFLKTNC

CRFQEKDEEGNLLDSYFVVKRHTMSNYQHEETIYNLVKDCPAVAVHDFFKFRVDGDMV

PHISRQRLTKYTMADLVYALRHFDEGNCDTLKEILVTYNCCDDDYFNKKDWYDFVENP

DILRVYANLGERVRQSLLKTVQFCDAMRDAGIVGVLTLDNQDLNGNWYDFGDFVQVAP

GCGVPIVDSYYSLLMPILTLTRALAAESHMDADLAKPLIKWDLLKYDFTEERLCLFDR

YFKYWDQTYHPNCINCLDDRCILHCANFNVLFSTVFPPTSFGPLVRKIFVDGVPFVVS

TGYHFRELGVVHNQDVNLHSSRLSFKELLVYAADPAMHAASGNLLLDKRTTCFSVAAL

TNNVAFQTVKPGNFNKDFYDFAVSKGFFKEGSSVELKHFFFAQDGNAAISDYDYYRYN

LPTMCDIRQLLFVVEVVDKYFDCYDGGCINANQVIVNNLDKSAGFPFNKWGKARLYYD

SMSYEDQDALFAYTKRNVIPTITQMNLKYAISAKNRARTVAGVSICSTMTNRQFHQKL

LKSIAATRGATVVIGTSKFYGGWHNMLKTVYSDVETPHLMGWDYPKCDRAMPNMLRIM

ASLVLARKHNTCCNLSHRFYRLANECAQVLSEMVMCGGSLYVKPGGTSSGDATTAYAN

SVFNICQAVTANVNALLSTDGNKIADKYVRNLQHRLYECLYRNRDVDHEFVDEFYAYL

RKHFSMMILSDDAVVCYNSNYAAQGLVASIKNFKAVLYYQNNVFMSEAKCWTETDLTK

GPHEFCSQHTMLVKQGDDYVYLPYPDPSRILGAGCFVDDIVKTDGTLMIERFVSLAID

AYPLTKHPNQEYADVFHLYLQYIRKLHDELTGHMLDMYSVMLTNDNTSRYWEPEFYEA

MYTPHTVLQAVGACVLCNSQTSLRCGACIRRPFLCCKCCYDHVISTSHKLVLSVNPYV

CNAPGCDVTDVTQLYLGGMSYYCKSHKPPISFPLCANGQVFGLYKNTCVGSDNVTDFN

AIATCDWTNAGDYILANTCTERLKLFAAETLKATEETFKLSYGIATVREVLSDRELHL

SWEVGKPRPPLNRNYVFTGYRVTKNSKVQIGEYTFEKGDYGDAVVYRGTTTYKLNVGD

YFVLTSHTVMPLSAPTLVPQEHYVRITGLYPTLNISDEFSSNVANYQKVGMQKYSTLQ

GPPGTGKSHFAIGLALYYPSARIVYTACSHAAVDALCEKALKYLPIDKCSRIIPARAR

VECFDKFKVNSTLEQYVFCTVNALPETTADIVVFDEISMATNYDLSVVNARLRAKHYV

YIGDPAQLPAPRTLLTKGTLEPEYFNSVCRLMKTIGPDMFLGTCRRCPAEIVDTVSAL

VYDNKLKAHKDKSAQCFKMFYKGVITHDVSSAINRPQIGVVREFLTRNPAWRKAVFIS

PYNSQNAVASKILGLPTQTVDSSQGSEYDYVIFTQTTETAHSCNVNRFNVAITRAKIG

ILCIMSDRDLYDKLQFTSLEIPRRNVATLQAENVTGLFKDCSKIITGLHPTQAPTHLS

VDIKFKTEGLCVDIPGIPKDMTYRRLISMMGFKMNYQVNGYPNMFITREEAIRHVRAW

IGFDVEGCHATRDAVGTNLPLQLGFSTGVNLVAVPTGYVDTENNTEFTRVNAKPPPGD

QFKHLIPLMYKGLPWNVVRIKIVQMLSDTLKGLSDRVVFVLWAHGFELTSMKYFVKIG

PERTCCLCDKRATCFSTSSDTYACWNHSVGFDYVYNPFMIDVQQWGFTGNLQSNHDQH

CQVHGNAHVASCDAIMTRCLAVHECFVKRVDWSVEYPIIGDELRVNSACRKVQHMVVK

SALLADKFPVLHDIGNPKAIKCVPQAEVEWKFYDAQPCSDKAYKIEELFYSYATHHDK

FTDGVCLFWNCNVDRYPANAIVCRFDTRVLSNLNLPGCDGGSLYVNKHAFHTPAFDKS

AFTNLKQLPFFYYSDSPCESHGKQVVSDIDYVPLKSATCITRCNLGGAVCRHHANEYR

QYLDAYNMMISAGFSLWIYKQFDTYNLWNTFTRLQSLENVAYNVVNKGHFDGHAGEAP

VSIINNAVYTKVDGIDVEIFENKTTLPVNVAFELWAKRNIKPVPEIKILNNLGVDIAA

NTVIWDYKREAPAHVSTIGVCTMTDIAKKPTESACSSLTVLFDGRVEGQVDLFRNARN

GVLITEGSVKGLTPSKGPAQASVNGVTLIGESVKTQFNYFKKVDGIIQQLPETYFTQS

RDLEDFKPRSQMETDFLELAMDEFIQRYKLEGYAFEHIVYGDFSHGQLGGLHLMIGLA

KRSQDSPLKLEDFIPMDSTVKNYFITDAQTGSSKCVCSVIDLLLDDFVEIIKSQDLSV

ISKVVKVTIDYAEISFMLWCKDGHVETFYPKLQASQAWQPGVAMPNLYKMQRMLLEKC

DLQNYGENAVIPKGIMMNVAKYTQLCQYLNTLTLAVPYNMRVIHFGAGSDKGVAPGTA

VLRQWLPTGTLLVDSDLNDFVSDADSTLIGDCATVHTANKWDLIISDMYDPRTKHVTK

ENDSKEGFFTYLCGFIKQKLALGGSIAVKITEHSWNADLYKLMGHFSWWTAFVTNVNA

SSSEAFLIGANYLGKPKEQIDGYTMHANYIFWRNTNPIQLSSYSLFDMSKFPLKLRGT

AVMSLKENQINDMIYSLLEKGRLIIRENNRVVVSSDILVNN”

CDS 21492..25259

/note=”surface spike glycoprotein”

/codon_start=1

/product=”S protein”

/protein_id=”AAP13441.1″

/db_xref=”GI:30027620″

/translation=”MFIFLLFLTLTSGSDLDRCTTFDDVQAPNYTQHTSSMRGVYYPD

EIFRSDTLYLTQDLFLPFYSNVTGFHTINHTFGNPVIPFKDGIYFAATEKSNVVRGWV

FGSTMNNKSQSVIIINNSTNVVIRACNFELCDNPFFAVSKPMGTQTHTMIFDNAFNCT

FEYISDAFSLDVSEKSGNFKHLREFVFKNKDGFLYVYKGYQPIDVVRDLPSGFNTLKP

IFKLPLGINITNFRAILTAFSPAQDIWGTSAAAYFVGYLKPTTFMLKYDENGTITDAV

DCSQNPLAELKCSVKSFEIDKGIYQTSNFRVVPSGDVVRFPNITNLCPFGEVFNATKF

PSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGD

DVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRP

FERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPA

TVCGPKLSTDLIKNQCVNFNFNGLTGTGVLTPSSKRFQPFQQFGRDVSDFTDSVRDPK

TSEILDISPCSFGGVSVITPGTNASSEVAVLYQDVNCTDVSTAIHADQLTPAWRIYST

GNNVFQTQAGCLIGAEHVDTSYECDIPIGAGICASYHTVSLLRSTSQKSIVAYTMSLG

ADSSIAYSNNTIAIPTNFSISITTEVMPVSMAKTSVDCNMYICGDSTECANLLLQYGS

FCTQLNRALSGIAAEQDRNTREVFAQVKQMYKTPTLKYFGGFNFSQILPDPLKPTKRS

FIEDLLFNKVTLADAGFMKQYGECLGDINARDLICAQKFNGLTVLPPLLTDDMIAAYT

AALVSGTATAGWTFGAGAALQIPFAMQMAYRFNGIGVTQNVLYENQKQIANQFNKAIS

QIQESLTTTSTALGKLQDVVNQNAQALNTLVKQLSSNFGAISSVLNDILSRLDKVEAE

VQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVLGQSKRVDFCGKGYH

LMSFPQAAPHGVVFLHVTYVPSQERNFTTAPAICHEGKAYFPREGVFVFNGTSWFITQ

RNFFSPQIITTDNTFVSGNCDVVIGIINNTVYDPLQPELDSFKEELDKYFKNHTSPDV

DLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYEQYIKWPWYVWLGFIA

GLIAIVMVTILLCCMTSCCSCLKGACSCGSCCKFDEDDSEPVLKGVKLHYT”

CDS 25268..26092

/note=”potential product, c-terminal similarity to porin”

/codon_start=1

/product=”protein X1″

/protein_id=”AAP13446.1″

/db_xref=”GI:30027625″

/translation=”MDLFMRFFTLGSITAQPVKIDNASPASTVHATATIPLQASLPFG

WLVIGVAFLAVFQSATKIIALNKRWQLALYKGFQFICNLLLLFVTIYSHLLLVAAGME

AQFLYLYALIYFLQCINACRIIMRCWLCWKCKSKNPLLYDANYFVCWHTHNYDYCIPY

NSVTDTIVVTEGDGISTPKLKEDYQIGGYSEDRHSGVKDYVVVHGYFTEVYYQLESTQ

ITTDTGIENATFFIFNKLVKDPPNVQIHTIDGSSGVANPAMDPIYDEPTTTTSVPL”

CDS 25689..26153

/note=”potential product”

/codon_start=1

/product=”protein X2″

/protein_id=”AAP13447.1″

/db_xref=”GI:30027626″

/translation=”MMPTTLFAGTHITMTTVYHITVSQIQLSLLKVTAFQHQNSKKTT

KLVVILRIGTQVLKTMSLYMAISPKFTTSLSLHKLLQTLVLKMLHSSSLTSLLKTHRM

CKYTQSTALQELLIQQWIQFMMSRRRLLACLCKHKKVSTNLCTHSFRKKQVR”

CDS 26117..26347

/note=”envelope protein”

/codon_start=1

/product=”E protein”

/protein_id=”AAP13443.1″

/db_xref=”GI:30027622″

/translation=”MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCC

NIVNVSLVKPTVYVYSRVKNLNSSEGVPDLLV”

CDS 26398..27063

/note=”small membrane protein”

/codon_start=1

/product=”M protein”

/protein_id=”AAP13444.1″

/db_xref=”GI:30027623″

/translation=”MADNGTITVEELKQLLEQWNLVIGFLFLAWIMLLQFAYSNRNRF

LYIIKLVFLWLLWPVTLACFVLAAVYRINWVTGGIAIAMACIVGLMWLSYFVASFRLF

ARTRSMWSFNPETNILLNVPLRGTIVTRPLMESELVIGAVIIRGHLRMAGHPLGRCDI

KDLPKEITVATSRTLSYYKLGASQRVGTDSGFAAYNRYRIGNYKLNTDHAGSNDNIAL

LVQ”

CDS 27074..27265

/note=”potential product”

/codon_start=1

/product=”protein X3″

/protein_id=”AAP13448.1″

/db_xref=”GI:30027627″

/translation=”MFHLVDFQVTIAEILIIIMRTFRIAIWNLDVIISSIVRQLFKPL

TKKNYSELDDEEPMELDYP”

CDS 27273..27641

/note=”potential product”

/codon_start=1

/product=”protein X4″

/protein_id=”AAP13449.1″

/db_xref=”GI:30027628″

/translation=”MKIILFLTLIVFTSCELYHYQECVRGTTVLLKEPCPSGTYEGNS

PFHPLADNKFALTCTSTHFAFACADGTRHTYQLRARSVSPKLFIRQEEVQQELYSPLF

LIVAALVFLILCFTIKRKTE”

CDS 27864..28118

/note=”potential product”

/codon_start=1

/product=”protein X5″

/protein_id=”AAP13450.1″

/db_xref=”GI:30027629″

/translation=”MCLKILVRYNTRGNTYSTAWLCALGKVLPFHRWHTMVQTCTPNV

TINCQDPAGGALIARCWYLHEGHQTAAFRDVLVVLNKRTN”

CDS 28120..29388

/note=”nucleocapsid protein”

/codon_start=1

/product=”N protein”

/protein_id=”AAP13445.1″

/db_xref=”GI:30027624″

/translation=”MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQ

GLPNNTASWFTALTQHGKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKM

KELSPRWYFYYLGTGPEASLPYGANKEGIVWVATEGALNTPKDHIGTRNPNNNAATVL

QLPQGTTLPKGFYAEGSRGGSQASSRSSSRSRGNSRNSTPGSSRGNSPARMASGGGET

ALALLLLDRLNQLESKVSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKQYNVTQAFG

RRGPEQTQGNFGDQDLIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTY

HGAIKLDDKDPQFKDNVILLNKHIDAYKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPT

VTLLPAADMDDFSRQLQNSMSGASADSTQA”

polyA_site 29727

BASE COUNT
ORIGIN

8455 a 5940 c 6188 g 9144 t

1 atattaggtt tttacctacc caggaaaagc caaccaacct cgatctcttg tagatctgtt

61 ctctaaacga actttaaaat ctgtgtagct gtcgctcggc tgcatgccta gtgcacctac

121 gcagtataaa caataataaa ttttactgtc gttgacaaga aacgagtaac tcgtccctct

181 tctgcagact gcttacggtt tcgtccgtgt tgcagtcgat catcagcata cctaggtttc

241 gtccgggtgt gaccgaaagg taagatggag agccttgttc ttggtgtcaa cgagaaaaca

301 cacgtccaac tcagtttgcc tgtccttcag gttagagacg tgctagtgcg tggcttcggg

361 gactctgtgg aagaggccct atcggaggca cgtgaacacc tcaaaaatgg cacttgtggt

421 ctagtagagc tggaaaaagg cgtactgccc cagcttgaac agccctatgt gttcattaaa

481 cgttctgatg ccttaagcac caatcacggc cacaaggtcg ttgagctggt tgcagaaatg

541 gacggcattc agtacggtcg tagcggtata acactgggag tactcgtgcc acatgtgggc

601 gaaaccccaa ttgcataccg caatgttctt cttcgtaaga acggtaataa gggagccggt

661 ggtcatagct atggcatcga tctaaagtct tatgacttag gtgacgagct tggcactgat

721 cccattgaag attatgaaca aaactggaac actaagcatg gcagtggtgc actccgtgaa

781 ctcactcgtg agctcaatgg aggtgcagtc actcgctatg tcgacaacaa tttctgtggc

841 ccagatgggt accctcttga ttgcatcaaa gattttctcg cacgcgcggg caagtcaatg

901 tgcactcttt ccgaacaact tgattacatc gagtcgaaga gaggtgtcta ctgctgccgt

961 gaccatgagc atgaaattgc ctggttcact gagcgctctg ataagagcta cgagcaccag

1021 acacccttcg aaattaagag tgccaagaaa tttgacactt tcaaagggga atgcccaaag

1081 tttgtgtttc ctcttaactc aaaagtcaaa gtcattcaac cacgtgttga aaagaaaaag

1141 actgagggtt tcatggggcg tatacgctct gtgtaccctg ttgcatctcc acaggagtgt

1201 aacaatatgc acttgtctac cttgatgaaa tgtaatcatt gcgatgaagt ttcatggcag

1261 acgtgcgact ttctgaaagc cacttgtgaa cattgtggca ctgaaaattt agttattgaa

1321 ggacctacta catgtgggta cctacctact aatgctgtag tgaaaatgcc atgtcctgcc

1381 tgtcaagacc cagagattgg acctgagcat agtgttgcag attatcacaa ccactcaaac

1441 attgaaactc gactccgcaa gggaggtagg actagatgtt ttggaggctg tgtgtttgcc

1501 tatgttggct gctataataa gcgtgcctac tgggttcctc gtgctagtgc tgatattggc

1561 tcaggccata ctggcattac tggtgacaat gtggagacct tgaatgagga tctccttgag

1621 atactgagtc gtgaacgtgt taacattaac attgttggcg attttcattt gaatgaagag

1681 gttgccatca ttttggcatc tttctctgct tctacaagtg cctttattga cactataaag

1741 agtcttgatt acaagtcttt caaaaccatt gttgagtcct gcggtaacta taaagttacc

1801 aagggaaagc ccgtaaaagg tgcttggaac attggacaac agagatcagt tttaacacca

1861 ctgtgtggtt ttccctcaca ggctgctggt gttatcagat caatttttgc gcgcacactt

1921 gatgcagcaa accactcaat tcctgatttg caaagagcag ctgtcaccat acttgatggt

1981 atttctgaac agtcattacg tcttgtcgac gccatggttt atacttcaga cctgctcacc

2041 aacagtgtca ttattatggc atatgtaact ggtggtcttg tacaacagac ttctcagtgg

2101 ttgtctaatc ttttgggcac tactgttgaa aaactcaggc ctatctttga atggattgag

2161 gcgaaactta gtgcaggagt tgaatttctc aaggatgctt gggagattct caaatttctc

2221 attacaggtg tttttgacat cgtcaagggt caaatacagg ttgcttcaga taacatcaag

2281 gattgtgtaa aatgcttcat tgatgttgtt aacaaggcac tcgaaatgtg cattgatcaa

2341 gtcactatcg ctggcgcaaa gttgcgatca ctcaacttag gtgaagtctt catcgctcaa

2401 agcaagggac tttaccgtca gtgtatacgt ggcaaggagc agctgcaact actcatgcct

2461 cttaaggcac caaaagaagt aacctttctt gaaggtgatt cacatgacac agtacttacc

2521 tctgaggagg ttgttctcaa gaacggtgaa ctcgaagcac tcgagacgcc cgttgatagc

2581 ttcacaaatg gagctatcgt tggcacacca gtctgtgtaa atggcctcat gctcttagag

2641 attaaggaca aagaacaata ctgcgcattg tctcctggtt tactggctac aaacaatgtc

2701 tttcgcttaa aagggggtgc accaattaaa ggtgtaacct ttggagaaga tactgtttgg

2761 gaagttcaag gttacaagaa tgtgagaatc acatttgagc ttgatgaacg tgttgacaaa

2821 gtgcttaatg aaaagtgctc tgtctacact gttgaatccg gtaccgaagt tactgagttt

2881 gcatgtgttg tagcagaggc tgttgtgaag actttacaac cagtttctga tctccttacc

2941 aacatgggta ttgatcttga tgagtggagt gtagctacat tctacttatt tgatgatgct

3001 ggtgaagaaa acttttcatc acgtatgtat tgttcctttt accctccaga tgaggaagaa

3061 gaggacgatg cagagtgtga ggaagaagaa attgatgaaa cctgtgaaca tgagtacggt

3121 acagaggatg attatcaagg tctccctctg gaatttggtg cctcagctga aacagttcga

3181 gttgaggaag aagaagagga agactggctg gatgatacta ctgagcaatc agagattgag

3241 ccagaaccag aacctacacc tgaagaacca gttaatcagt ttactggtta tttaaaactt

3301 actgacaatg ttgccattaa atgtgttgac atcgttaagg aggcacaaag tgctaatcct

3361 atggtgattg taaatgctgc taacatacac ctgaaacatg gtggtggtgt agcaggtgca

3421 ctcaacaagg caaccaatgg tgccatgcaa aaggagagtg atgattacat taagctaaat

3481 ggccctctta cagtaggagg gtcttgtttg ctttctggac ataatcttgc taagaagtgt

3541 ctgcatgttg ttggacctaa cctaaatgca ggtgaggaca tccagcttct taaggcagca

3601 tatgaaaatt tcaattcaca ggacatctta cttgcaccat tgttgtcagc aggcatattt

3661 ggtgctaaac cacttcagtc tttacaagtg tgcgtgcaga cggttcgtac acaggtttat

3721 attgcagtca atgacaaagc tctttatgag caggttgtca tggattatct tgataacctg

3781 aagcctagag tggaagcacc taaacaagag gagccaccaa acacagaaga ttccaaaact

3841 gaggagaaat ctgtcgtaca gaagcctgtc gatgtgaagc caaaaattaa ggcctgcatt

3901 gatgaggtta ccacaacact ggaagaaact aagtttctta ccaataagtt actcttgttt

3961 gctgatatca atggtaagct ttaccatgat tctcagaaca tgcttagagg tgaagatatg

4021 tctttccttg agaaggatgc accttacatg gtaggtgatg ttatcactag tggtgatatc

4081 acttgtgttg taataccctc caaaaaggct ggtggcacta ctgagatgct ctcaagagct

4141 ttgaagaaag tgccagttga tgagtatata accacgtacc ctggacaagg atgtgctggt

4201 tatacacttg aggaagctaa gactgctctt aagaaatgca aatctgcatt ttatgtacta

4261 ccttcagaag cacctaatgc taaggaagag attctaggaa ctgtatcctg gaatttgaga

4321 gaaatgcttg ctcatgctga agagacaaga aaattaatgc ctatatgcat ggatgttaga

4381 gccataatgg caaccatcca acgtaagtat aaaggaatta aaattcaaga gggcatcgtt

4441 gactatggtg tccgattctt cttttatact agtaaagagc ctgtagcttc tattattacg

4501 aagctgaact ctctaaatga gccgcttgtc acaatgccaa ttggttatgt gacacatggt

4561 tttaatcttg aagaggctgc gcgctgtatg cgttctctta aagctcctgc cgtagtgtca

4621 gtatcatcac cagatgctgt tactacatat aatggatacc tcacttcgtc atcaaagaca

4681 tctgaggagc actttgtaga aacagtttct ttggctggct cttacagaga ttggtcctat

4741 tcaggacagc gtacagagtt aggtgttgaa tttcttaagc gtggtgacaa aattgtgtac

4801 cacactctgg agagccccgt cgagtttcat cttgacggtg aggttctttc acttgacaaa

4861 ctaaagagtc tcttatccct gcgggaggtt aagactataa aagtgttcac aactgtggac

4921 aacactaatc tccacacaca gcttgtggat atgtctatga catatggaca gcagtttggt

4981 ccaacatact tggatggtgc tgatgttaca aaaattaaac ctcatgtaaa tcatgagggt

5041 aagactttct ttgtactacc tagtgatgac acactacgta gtgaagcttt cgagtactac

5101 catactcttg atgagagttt tcttggtagg tacatgtctg ctttaaacca cacaaagaaa

5161 tggaaatttc ctcaagttgg tggtttaact tcaattaaat gggctgataa caattgttat

5221 ttgtctagtg ttttattagc acttcaacag cttgaagtca aattcaatgc accagcactt

5281 caagaggctt attatagagc ccgtgctggt gatgctgcta acttttgtgc actcatactc

5341 gcttacagta ataaaactgt tggcgagctt ggtgatgtca gagaaactat gacccatctt

5401 ctacagcatg ctaatttgga atctgcaaag cgagttctta atgtggtgtg taaacattgt

5461 ggtcagaaaa ctactacctt aacgggtgta gaagctgtga tgtatatggg tactctatct

5521 tatgataatc ttaagacagg tgtttccatt ccatgtgtgt gtggtcgtga tgctacacaa

5581 tatctagtac aacaagagtc ttcttttgtt atgatgtctg caccacctgc tgagtataaa

5641 ttacagcaag gtacattctt atgtgcgaat gagtacactg gtaactatca gtgtggtcat

5701 tacactcata taactgctaa ggagaccctc tatcgtattg acggagctca ccttacaaag

5761 atgtcagagt acaaaggacc agtgactgat gttttctaca aggaaacatc ttacactaca

5821 accatcaagc ctgtgtcgta taaactcgat ggagttactt acacagagat tgaaccaaaa

5881 ttggatgggt attataaaaa ggataatgct tactatacag agcagcctat agaccttgta

5941 ccaactcaac cattaccaaa tgcgagtttt gataatttca aactcacatg ttctaacaca

6001 aaatttgctg atgatttaaa tcaaatgaca ggcttcacaa agccagcttc acgagagcta

6061 tctgtcacat tcttcccaga cttgaatggc gatgtagtgg ctattgacta tagacactat

6121 tcagcgagtt tcaagaaagg tgctaaatta ctgcataagc caattgtttg gcacattaac

6181 caggctacaa ccaagacaac gttcaaacca aacacttggt gtttacgttg tctttggagt

6241 acaaagccag tagatacttc aaattcattt gaagttctgg cagtagaaga cacacaagga

6301 atggacaatc ttgcttgtga aagtcaacaa cccacctctg aagaagtagt ggaaaatcct

6361 accatacaga aggaagtcat agagtgtgac gtgaaaacta ccgaagttgt aggcaatgtc

6421 atacttaaac catcagatga aggtgttaaa gtaacacaag agttaggtca tgaggatctt

6481 atggctgctt atgtggaaaa cacaagcatt accattaaga aacctaatga gctttcacta

6541 gccttaggtt taaaaacaat tgccactcat ggtattgctg caattaatag tgttccttgg

6601 agtaaaattt tggcttatgt caaaccattc ttaggacaag cagcaattac aacatcaaat

6661 tgcgctaaga gattagcaca acgtgtgttt aacaattata tgccttatgt gtttacatta

6721 ttgttccaat tgtgtacttt tactaaaagt accaattcta gaattagagc ttcactacct

6781 acaactattg ctaaaaatag tgttaagagt gttgctaaat tatgtttgga tgccggcatt

6841 aattatgtga agtcacccaa attttctaaa ttgttcacaa tcgctatgtg gctattgttg

6901 ttaagtattt gcttaggttc tctaatctgt gtaactgctg cttttggtgt actcttatct

6961 aattttggtg ctccttctta ttgtaatggc gttagagaat tgtatcttaa ttcgtctaac

7021 gttactacta tggatttctg tgaaggttct tttccttgca gcatttgttt aagtggatta

7081 gactcccttg attcttatcc agctcttgaa accattcagg tgacgatttc atcgtacaag

7141 ctagacttga caattttagg tctggccgct gagtgggttt tggcatatat gttgttcaca

7201 aaattctttt atttattagg tctttcagct ataatgcagg tgttctttgg ctattttgct

7261 agtcatttca tcagcaattc ttggctcatg tggtttatca ttagtattgt acaaatggca

7321 cccgtttctg caatggttag gatgtacatc ttctttgctt ctttctacta catatggaag

7381 agctatgttc atatcatgga tggttgcacc tcttcgactt gcatgatgtg ctataagcgc

7441 aatcgtgcca cacgcgttga gtgtacaact attgttaatg gcatgaagag atctttctat

7501 gtctatgcaa atggaggccg tggcttctgc aagactcaca attggaattg tctcaattgt

7561 gacacatttt gcactggtag tacattcatt agtgatgaag ttgctcgtga tttgtcactc

7621 cagtttaaaa gaccaatcaa ccctactgac cagtcatcgt atattgttga tagtgttgct

7681 gtgaaaaatg gcgcgcttca cctctacttt gacaaggctg gtcaaaagac ctatgagaga

7741 catccgctct cccattttgt caatttagac aatttgagag ctaacaacac taaaggttca

7801 ctgcctatta atgtcatagt ttttgatggc aagtccaaat gcgacgagtc tgcttctaag

7861 tctgcttctg tgtactacag tcagctgatg tgccaaccta ttctgttgct tgaccaagtt

7921 cttgtatcag acgttggaga tagtactgaa gtttccgtta agatgtttga tgcttatgtc

7981 gacacctttt cagcaacttt tagtgttcct atggaaaaac ttaaggcact tgttgctaca

8041 gctcacagcg agttagcaaa gggtgtagct ttagatggtg tcctttctac attcgtgtca

8101 gctgcccgac aaggtgttgt tgataccgat gttgacacaa aggatgttat tgaatgtctc

8161 aaactttcac atcactctga cttagaagtg acaggtgaca gttgtaacaa tttcatgctc

8221 acctataata aggttgaaaa catgacgccc agagatcttg gcgcatgtat tgactgtaat

8281 gcaaggcata tcaatgccca agtagcaaaa agtcacaatg tttcactcat ctggaatgta

8341 aaagactaca tgtctttatc tgaacagctg cgtaaacaaa ttcgtagtgc tgccaagaag

8401 aacaacatac cttttagact aacttgtgct acaactagac aggttgtcaa tgtcataact

8461 actaaaatct cactcaaggg tggtaagatt gttagtactt gttttaaact tatgcttaag

8521 gccacattat tgtgcgttct tgctgcattg gtttgttata tcgttatgcc agtacataca

8581 ttgtcaatcc atgatggtta cacaaatgaa atcattggtt acaaagccat tcaggatggt

8641 gtcactcgtg acatcatttc tactgatgat tgttttgcaa ataaacatgc tggttttgac

8701 gcatggttta gccagcgtgg tggttcatac aaaaatgaca aaagctgccc tgtagtagct

8761 gctatcatta caagagagat tggtttcata gtgcctggct taccgggtac tgtgctgaga

8821 gcaatcaatg gtgacttctt gcattttcta cctcgtgttt ttagtgctgt tggcaacatt

8881 tgctacacac cttccaaact cattgagtat agtgattttg ctacctctgc ttgcgttctt

8941 gctgctgagt gtacaatttt taaggatgct atgggcaaac ctgtgccata ttgttatgac

9001 actaatttgc tagagggttc tatttcttat agtgagcttc gtccagacac tcgttatgtg

9061 cttatggatg gttccatcat acagtttcct aacacttacc tggagggttc tgttagagta

9121 gtaacaactt ttgatgctga gtactgtaga catggtacat gcgaaaggtc agaagtaggt

9181 atttgcctat ctaccagtgg tagatgggtt cttaataatg agcattacag agctctatca

9241 ggagttttct gtggtgttga tgcgatgaat ctcatagcta acatctttac tcctcttgtg

9301 caacctgtgg gtgctttaga tgtgtctgct tcagtagtgg ctggtggtat tattgccata

9361 ttggtgactt gtgctgccta ctactttatg aaattcagac gtgtttttgg tgagtacaac

9421 catgttgttg ctgctaatgc acttttgttt ttgatgtctt tcactatact ctgtctggta

9481 ccagcttaca gctttctgcc gggagtctac tcagtctttt acttgtactt gacattctat

9541 ttcaccaatg atgtttcatt cttggctcac cttcaatggt ttgccatgtt ttctcctatt

9601 gtgccttttt ggataacagc aatctatgta ttctgtattt ctctgaagca ctgccattgg

9661 ttctttaaca actatcttag gaaaagagtc atgtttaatg gagttacatt tagtaccttc

9721 gaggaggctg ctttgtgtac ctttttgctc aacaaggaaa tgtacctaaa attgcgtagc

9781 gagacactgt tgccacttac acagtataac aggtatcttg ctctatataa caagtacaag

9841 tatttcagtg gagccttaga tactaccagc tatcgtgaag cagcttgctg ccacttagca

9901 aaggctctaa atgactttag caactcaggt gctgatgttc tctaccaacc accacagaca

9961 tcaatcactt ctgctgttct gcagagtggt tttaggaaaa tggcattccc gtcaggcaaa

10021 gttgaagggt gcatggtaca agtaacctgt ggaactacaa ctcttaatgg attgtggttg

10081 gatgacacag tatactgtcc aagacatgtc atttgcacag cagaagacat gcttaatcct

10141 aactatgaag atctgctcat tcgcaaatcc aaccatagct ttcttgttca ggctggcaat

10201 gttcaacttc gtgttattgg ccattctatg caaaattgtc tgcttaggct taaagttgat

10261 acttctaacc ctaagacacc caagtataaa tttgtccgta tccaacctgg tcaaacattt

10321 tcagttctag catgctacaa tggttcacca tctggtgttt atcagtgtgc catgagacct

10381 aatcatacca ttaaaggttc tttccttaat ggatcatgtg gtagtgttgg ttttaacatt

10441 gattatgatt gcgtgtcttt ctgctatatg catcatatgg agcttccaac aggagtacac

10501 gctggtactg acttagaagg taaattctat ggtccatttg ttgacagaca aactgcacag

10561 gctgcaggta cagacacaac cataacatta aatgttttgg catggctgta tgctgctgtt

10621 atcaatggtg ataggtggtt tcttaataga ttcaccacta ctttgaatga ctttaacctt

10681 gtggcaatga agtacaacta tgaacctttg acacaagatc atgttgacat attgggacct

10741 ctttctgctc aaacaggaat tgccgtctta gatatgtgtg ctgctttgaa agagctgctg

10801 cagaatggta tgaatggtcg tactatcctt ggtagcacta ttttagaaga tgagtttaca

10861 ccatttgatg ttgttagaca atgctctggt gttaccttcc aaggtaagtt caagaaaatt

10921 gttaagggca ctcatcattg gatgctttta actttcttga catcactatt gattcttgtt

10981 caaagtacac agtggtcact gtttttcttt gtttacgaga atgctttctt gccatttact

11041 cttggtatta tggcaattgc tgcatgtgct atgctgcttg ttaagcataa gcacgcattc

11101 ttgtgcttgt ttctgttacc ttctcttgca acagttgctt actttaatat ggtctacatg

11161 cctgctagct gggtgatgcg tatcatgaca tggcttgaat tggctgacac tagcttgtct

11221 ggttataggc ttaaggattg tgttatgtat gcttcagctt tagttttgct tattctcatg

11281 acagctcgca ctgtttatga tgatgctgct agacgtgttt ggacactgat gaatgtcatt

11341 acacttgttt acaaagtcta ctatggtaat gctttagatc aagctatttc catgtgggcc

11401 ttagttattt ctgtaacctc taactattct ggtgtcgtta cgactatcat gtttttagct

11461 agagctatag tgtttgtgtg tgttgagtat tacccattgt tatttattac tggcaacacc

11521 ttacagtgta tcatgcttgt ttattgtttc ttaggctatt gttgctgctg ctactttggc

11581 cttttctgtt tactcaaccg ttacttcagg cttactcttg gtgtttatga ctacttggtc

11641 tctacacaag aatttaggta tatgaactcc caggggcttt tgcctcctaa gagtagtatt

11701 gatgctttca agcttaacat taagttgttg ggtattggag gtaaaccatg tatcaaggtt

11761 gctactgtac agtctaaaat gtctgacgta aagtgcacat ctgtggtact gctctcggtt

11821 cttcaacaac ttagagtaga gtcatcttct aaattgtggg cacaatgtgt acaactccac

11881 aatgatattc ttcttgcaaa agacacaact gaagctttcg agaagatggt ttctcttttg

11941 tctgttttgc tatccatgca gggtgctgta gacattaata ggttgtgcga ggaaatgctc

12001 gataaccgtg ctactcttca ggctattgct tcagaattta gttctttacc atcatatgcc

12061 gcttatgcca ctgcccagga ggcctatgag caggctgtag ctaatggtga ttctgaagtc

12121 gttctcaaaa agttaaagaa atctttgaat gtggctaaat ctgagtttga ccgtgatgct

12181 gccatgcaac gcaagttgga aaagatggca gatcaggcta tgacccaaat gtacaaacag

12241 gcaagatctg aggacaagag ggcaaaagta actagtgcta tgcaaacaat gctcttcact

12301 atgcttagga agcttgataa tgatgcactt aacaacatta tcaacaatgc gcgtgatggt

12361 tgtgttccac tcaacatcat accattgact acagcagcca aactcatggt tgttgtccct

12421 gattatggta cctacaagaa cacttgtgat ggtaacacct ttacatatgc atctgcactc

12481 tgggaaatcc agcaagttgt tgatgcggat agcaagattg ttcaacttag tgaaattaac

12541 atggacaatt caccaaattt ggcttggcct cttattgtta cagctctaag agccaactca

12601 gctgttaaac tacagaataa tgaactgagt ccagtagcac tacgacagat gtcctgtgcg

12661 gctggtacca cacaaacagc ttgtactgat gacaatgcac ttgcctacta taacaattcg

12721 aagggaggta ggtttgtgct ggcattacta tcagaccacc aagatctcaa atgggctaga

12781 ttccctaaga gtgatggtac aggtacaatt tacacagaac tggaaccacc ttgtaggttt

12841 gttacagaca caccaaaagg gcctaaagtg aaatacttgt acttcatcaa aggcttaaac

12901 aacctaaata gaggtatggt gctgggcagt ttagctgcta cagtacgtct tcaggctgga

12961 aatgctacag aagtacctgc caattcaact gtgctttcct tctgtgcttt tgcagtagac

13021 cctgctaaag catataagga ttacctagca agtggaggac aaccaatcac caactgtgtg

13081 aagatgttgt gtacacacac tggtacagga caggcaatta ctgtaacacc agaagctaac

13141 atggaccaag agtcctttgg tggtgcttca tgttgtctgt attgtagatg ccacattgac

13201 catccaaatc ctaaaggatt ctgtgacttg aaaggtaagt acgtccaaat acctaccact

13261 tgtgctaatg acccagtggg ttttacactt agaaacacag tctgtaccgt ctgcggaatg

13321 tggaaaggtt atggctgtag ttgtgaccaa ctccgcgaac ccttgatgca gtctgcggat

13381 gcatcaacgt ttttaaacgg gtttgcggtg taagtgcagc ccgtcttaca ccgtgcggca

13441 caggcactag tactgatgtc gtctacaggg cttttgatat ttacaacgaa aaagttgctg

13501 gttttgcaaa gttcctaaaa actaattgct gtcgcttcca ggagaaggat gaggaaggca

13561 atttattaga ctcttacttt gtagttaaga ggcatactat gtctaactac caacatgaag

13621 agactattta taacttggtt aaagattgtc cagcggttgc tgtccatgac tttttcaagt

13681 ttagagtaga tggtgacatg gtaccacata tatcacgtca gcgtctaact aaatacacaa

13741 tggctgattt agtctatgct ctacgtcatt ttgatgaggg taattgtgat acattaaaag

13801 aaatactcgt cacatacaat tgctgtgatg atgattattt caataagaag gattggtatg

13861 acttcgtaga gaatcctgac atcttacgcg tatatgctaa cttaggtgag cgtgtacgcc

13921 aatcattatt aaagactgta caattctgcg atgctatgcg tgatgcaggc attgtaggcg

13981 tactgacatt agataatcag gatcttaatg ggaactggta cgatttcggt gatttcgtac

14041 aagtagcacc aggctgcgga gttcctattg tggattcata ttactcattg ctgatgccca

14101 tcctcacttt gactagggca ttggctgctg agtcccatat ggatgctgat ctcgcaaaac

14161 cacttattaa gtgggatttg ctgaaatatg attttacgga agagagactt tgtctcttcg

14221 accgttattt taaatattgg gaccagacat accatcccaa ttgtattaac tgtttggatg

14281 ataggtgtat ccttcattgt gcaaacttta atgtgttatt ttctactgtg tttccaccta

14341 caagttttgg accactagta agaaaaatat ttgtagatgg tgttcctttt gttgtttcaa

14401 ctggatacca ttttcgtgag ttaggagtcg tacataatca ggatgtaaac ttacatagct

14461 cgcgtctcag tttcaaggaa cttttagtgt atgctgctga tccagctatg catgcagctt

14521 ctggcaattt attgctagat aaacgcacta catgcttttc agtagctgca ctaacaaaca

14581 atgttgcttt tcaaactgtc aaacccggta attttaataa agacttttat gactttgctg

14641 tgtctaaagg tttctttaag gaaggaagtt ctgttgaact aaaacacttc ttctttgctc

14701 aggatggcaa cgctgctatc agtgattatg actattatcg ttataatctg ccaacaatgt

14761 gtgatatcag acaactccta ttcgtagttg aagttgttga taaatacttt gattgttacg

14821 atggtggctg tattaatgcc aaccaagtaa tcgttaacaa tctggataaa tcagctggtt

14881 tcccatttaa taaatggggt aaggctagac tttattatga ctcaatgagt tatgaggatc

14941 aagatgcact tttcgcgtat actaagcgta atgtcatccc tactataact caaatgaatc

15001 ttaagtatgc cattagtgca aagaatagag ctcgcaccgt agctggtgtc tctatctgta

15061 gtactatgac aaatagacag tttcatcaga aattattgaa gtcaatagcc gccactagag

15121 gagctactgt ggtaattgga acaagcaagt tttacggtgg ctggcataat atgttaaaaa

15181 ctgtttacag tgatgtagaa actccacacc ttatgggttg ggattatcca aaatgtgaca

15241 gagccatgcc taacatgctt aggataatgg cctctcttgt tcttgctcgc aaacataaca

15301 cttgctgtaa cttatcacac cgtttctaca ggttagctaa cgagtgtgcg caagtattaa

15361 gtgagatggt catgtgtggc ggctcactat atgttaaacc aggtggaaca tcatccggtg

15421 atgctacaac tgcttatgct aatagtgtct ttaacatttg tcaagctgtt acagccaatg

15481 taaatgcact tctttcaact gatggtaata agatagctga caagtatgtc cgcaatctac

15541 aacacaggct ctatgagtgt ctctatagaa atagggatgt tgatcatgaa ttcgtggatg

15601 agttttacgc ttacctgcgt aaacatttct ccatgatgat tctttctgat gatgccgttg

15661 tgtgctataa cagtaactat gcggctcaag gtttagtagc tagcattaag aactttaagg

15721 cagttcttta ttatcaaaat aatgtgttca tgtctgaggc aaaatgttgg actgagactg

15781 accttactaa aggacctcac gaattttgct cacagcatac aatgctagtt aaacaaggag

15841 atgattacgt gtacctgcct tacccagatc catcaagaat attaggcgca ggctgttttg

15901 tcgatgatat tgtcaaaaca gatggtacac ttatgattga aaggttcgtg tcactggcta

15961 ttgatgctta cccacttaca aaacatccta atcaggagta tgctgatgtc tttcacttgt

16021 atttacaata cattagaaag ttacatgatg agcttactgg ccacatgttg gacatgtatt

16081 ccgtaatgct aactaatgat aacacctcac ggtactggga acctgagttt tatgaggcta

16141 tgtacacacc acatacagtc ttgcaggctg taggtgcttg tgtattgtgc aattcacaga

16201 cttcacttcg ttgcggtgcc tgtattagga gaccattcct atgttgcaag tgctgctatg

16261 accatgtcat ttcaacatca cacaaattag tgttgtctgt taatccctat gtttgcaatg

16321 ccccaggttg tgatgtcact gatgtgacac aactgtatct aggaggtatg agctattatt

16381 gcaagtcaca taagcctccc attagttttc cattatgtgc taatggtcag gtttttggtt

16441 tatacaaaaa cacatgtgta ggcagtgaca atgtcactga cttcaatgcg atagcaacat

16501 gtgattggac taatgctggc gattacatac ttgccaacac ttgtactgag agactcaagc

16561 ttttcgcagc agaaacgctc aaagccactg aggaaacatt taagctgtca tatggtattg

16621 ctactgtacg cgaagtactc tctgacagag aattgcatct ttcatgggag gttggaaaac

16681 ctagaccacc attgaacaga aactatgtct ttactggtta ccgtgtaact aaaaatagta

16741 aagtacagat tggagagtac acctttgaaa aaggtgacta tggtgatgct gttgtgtaca

16801 gaggtactac gacatacaag ttgaatgttg gtgattactt tgtgttgaca tctcacactg

16861 taatgccact tagtgcacct actctagtgc cacaagagca ctatgtgaga attactggct

16921 tgtacccaac actcaacatc tcagatgagt tttctagcaa tgttgcaaat tatcaaaagg

16981 tcggcatgca aaagtactct acactccaag gaccacctgg tactggtaag agtcattttg

17041 ccatcggact tgctctctat tacccatctg ctcgcatagt gtatacggca tgctctcatg

17101 cagctgttga tgccctatgt gaaaaggcat taaaatattt gcccatagat aaatgtagta

17161 gaatcatacc tgcgcgtgcg cgcgtagagt gttttgataa attcaaagtg aattcaacac

17221 tagaacagta tgttttctgc actgtaaatg cattgccaga aacaactgct gacattgtag

17281 tctttgatga aatctctatg gctactaatt atgacttgag tgttgtcaat gctagacttc

17341 gtgcaaaaca ctacgtctat attggcgatc ctgctcaatt accagccccc cgcacattgc

17401 tgactaaagg cacactagaa ccagaatatt ttaattcagt gtgcagactt atgaaaacaa

17461 taggtccaga catgttcctt ggaacttgtc gccgttgtcc tgctgaaatt gttgacactg

17521 tgagtgcttt agtttatgac aataagctaa aagcacacaa ggataagtca gctcaatgct

17581 tcaaaatgtt ctacaaaggt gttattacac atgatgtttc atctgcaatc aacagacctc

17641 aaataggcgt tgtaagagaa tttcttacac gcaatcctgc ttggagaaaa gctgttttta

17701 tctcacctta taattcacag aacgctgtag cttcaaaaat cttaggattg cctacgcaga

17761 ctgttgattc atcacagggt tctgaatatg actatgtcat attcacacaa actactgaaa

17821 cagcacactc ttgtaatgtc aaccgcttca atgtggctat cacaagggca aaaattggca

17881 ttttgtgcat aatgtctgat agagatcttt atgacaaact gcaatttaca agtctagaaa

17941 taccacgtcg caatgtggct acattacaag cagaaaatgt aactggactt tttaaggact

18001 gtagtaagat cattactggt cttcatccta cacaggcacc tacacacctc agcgttgata

18061 taaagttcaa gactgaagga ttatgtgttg acataccagg cataccaaag gacatgacct

18121 accgtagact catctctatg atgggtttca aaatgaatta ccaagtcaat ggttacccta

18181 atatgtttat cacccgcgaa gaagctattc gtcacgttcg tgcgtggatt ggctttgatg

18241 tagagggctg tcatgcaact agagatgctg tgggtactaa cctacctctc cagctaggat

18301 tttctacagg tgttaactta gtagctgtac cgactggtta tgttgacact gaaaataaca

18361 cagaattcac cagagttaat gcaaaacctc caccaggtga ccagtttaaa catcttatac

18421 cactcatgta taaaggcttg ccctggaatg tagtgcgtat taagatagta caaatgctca

18481 gtgatacact gaaaggattg tcagacagag tcgtgttcgt cctttgggcg catggctttg

18541 agcttacatc aatgaagtac tttgtcaaga ttggacctga aagaacgtgt tgtctgtgtg

18601 acaaacgtgc aacttgcttt tctacttcat cagatactta tgcctgctgg aatcattctg

18661 tgggttttga ctatgtctat aacccattta tgattgatgt tcagcagtgg ggctttacgg

18721 gtaaccttca gagtaaccat gaccaacatt gccaggtaca tggaaatgca catgtggcta

18781 gttgtgatgc tatcatgact agatgtttag cagtccatga gtgctttgtt aagcgcgttg

18841 attggtctgt tgaataccct attataggag atgaactgag ggttaattct gcttgcagaa

18901 aagtacaaca catggttgtg aagtctgcat tgcttgctga taagtttcca gttcttcatg

18961 acattggaaa tccaaaggct atcaagtgtg tgcctcaggc tgaagtagaa tggaagttct

19021 acgatgctca gccatgtagt gacaaagctt acaaaataga ggagctcttc tattcttatg

19081 ctacacatca cgataaattc actgatggtg tttgtttgtt ttggaattgt aacgttgatc

19141 gttacccagc caatgcaatt gtgtgtaggt ttgacacaag agtcttgtca aacttgaact

19201 taccaggctg tgatggtggt agtttgtatg tgaataagca tgcattccac actccagctt

19261 tcgataaaag tgcatttact aatttaaagc aattgccttt cttttactat tctgatagtc

19321 cttgtgagtc tcatggcaaa caagtagtgt cggatattga ttatgttcca ctcaaatctg

19381 ctacgtgtat tacacgatgc aatttaggtg gtgctgtttg cagacaccat gcaaatgagt

19441 accgacagta cttggatgca tataatatga tgatttctgc tggatttagc ctatggattt

19501 acaaacaatt tgatacttat aacctgtgga atacatttac caggttacag agtttagaaa

19561 atgtggctta taatgttgtt aataaaggac actttgatgg acacgccggc gaagcacctg

19621 tttccatcat taataatgct gtttacacaa aggtagatgg tattgatgtg gagatctttg

19681 aaaataagac aacacttcct gttaatgttg catttgagct ttgggctaag cgtaacatta

19741 aaccagtgcc agagattaag atactcaata atttgggtgt tgatatcgct gctaatactg

19801 taatctggga ctacaaaaga gaagccccag cacatgtatc tacaataggt gtctgcacaa

19861 tgactgacat tgccaagaaa cctactgaga gtgcttgttc ttcacttact gtcttgtttg

19921 atggtagagt ggaaggacag gtagaccttt ttagaaacgc ccgtaatggt gttttaataa

19981 cagaaggttc agtcaaaggt ctaacacctt caaagggacc agcacaagct agcgtcaatg

20041 gagtcacatt aattggagaa tcagtaaaaa cacagtttaa ctactttaag aaagtagacg

20101 gcattattca acagttgcct gaaacctact ttactcagag cagagactta gaggatttta

20161 agcccagatc acaaatggaa actgactttc tcgagctcgc tatggatgaa ttcatacagc

20221 gatataagct cgagggctat gccttcgaac acatcgttta tggagatttc agtcatggac

20281 aacttggcgg tcttcattta atgataggct tagccaagcg ctcacaagat tcaccactta

20341 aattagagga ttttatccct atggacagca cagtgaaaaa ttacttcata acagatgcgc

20401 aaacaggttc atcaaaatgt gtgtgttctg tgattgatct tttacttgat gactttgtcg

20461 agataataaa gtcacaagat ttgtcagtga tttcaaaagt ggtcaaggtt acaattgact

20521 atgctgaaat ttcattcatg ctttggtgta aggatggaca tgttgaaacc ttctacccaa

20581 aactacaagc aagtcaagcg tggcaaccag gtgttgcgat gcctaacttg tacaagatgc

20641 aaagaatgct tcttgaaaag tgtgaccttc agaattatgg tgaaaatgct gttataccaa

20701 aaggaataat gatgaatgtc gcaaagtata ctcaactgtg tcaatactta aatacactta

20761 ctttagctgt accctacaac atgagagtta ttcactttgg tgctggctct gataaaggag

20821 ttgcaccagg tacagctgtg ctcagacaat ggttgccaac tggcacacta cttgtcgatt

20881 cagatcttaa tgacttcgtc tccgacgcag attctacttt aattggagac tgtgcaacag

20941 tacatacggc taataaatgg gaccttatta ttagcgatat gtatgaccct aggaccaaac

21001 atgtgacaaa agagaatgac tctaaagaag ggtttttcac ttatctgtgt ggatttataa

21061 agcaaaaact agccctgggt ggttctatag ctgtaaagat aacagagcat tcttggaatg

21121 ctgaccttta caagcttatg ggccatttct catggtggac agcttttgtt acaaatgtaa

21181 atgcatcatc atcggaagca tttttaattg gggctaacta tcttggcaag ccgaaggaac

21241 aaattgatgg ctataccatg catgctaact acattttctg gaggaacaca aatcctatcc

21301 agttgtcttc ctattcactc tttgacatga gcaaatttcc tcttaaatta agaggaactg

21361 ctgtaatgtc tcttaaggag aatcaaatca atgatatgat ttattctctt ctggaaaaag

21421 gtaggcttat cattagagaa aacaacagag ttgtggtttc aagtgatatt cttgttaaca

21481 actaaacgaa catgtttatt ttcttattat ttcttactct cactagtggt agtgaccttg

21541 accggtgcac cacttttgat gatgttcaag ctcctaatta cactcaacat acttcatcta

21601 tgaggggggt ttactatcct gatgaaattt ttagatcaga cactctttat ttaactcagg

21661 atttatttct tccattttat tctaatgtta cagggtttca tactattaat catacgtttg

21721 gcaaccctgt catacctttt aaggatggta tttattttgc tgccacagag aaatcaaatg

21781 ttgtccgtgg ttgggttttt ggttctacca tgaacaacaa gtcacagtcg gtgattatta

21841 ttaacaattc tactaatgtt gttatacgag catgtaactt tgaattgtgt gacaaccctt

21901 tctttgctgt ttctaaaccc atgggtacac agacacatac tatgatattc gataatgcat

21961 ttaattgcac tttcgagtac atatctgatg ccttttcgct tgatgtttca gaaaagtcag

22021 gtaattttaa acacttacga gagtttgtgt ttaaaaataa agatgggttt ctctatgttt

22081 ataagggcta tcaacctata gatgtagttc gtgatctacc ttctggtttt aacactttga

22141 aacctatttt taagttgcct cttggtatta acattacaaa ttttagagcc attcttacag

22201 ccttttcacc tgctcaagac atttggggca cgtcagctgc agcctatttt gttggctatt

22261 taaagccaac tacatttatg ctcaagtatg atgaaaatgg tacaatcaca gatgctgttg

22321 attgttctca aaatccactt gctgaactca aatgctctgt taagagcttt gagattgaca

22381 aaggaattta ccagacctct aatttcaggg ttgttccctc aggagatgtt gtgagattcc

22441 ctaatattac aaacttgtgt ccttttggag aggtttttaa tgctactaaa ttcccttctg

22501 tctatgcatg ggagagaaaa aaaatttcta attgtgttgc tgattactct gtgctctaca

22561 actcaacatt tttttcaacc tttaagtgct atggcgtttc tgccactaag ttgaatgatc

22621 tttgcttctc caatgtctat gcagattctt ttgtagtcaa gggagatgat gtaagacaaa

22681 tagcgccagg acaaactggt gttattgctg attataatta taaattgcca gatgatttca

22741 tgggttgtgt ccttgcttgg aatactagga acattgatgc tacttcaact ggtaattata

22801 attataaata taggtatctt agacatggca agcttaggcc ctttgagaga gacatatcta

22861 atgtgccttt ctcccctgat ggcaaacctt gcaccccacc tgctcttaat tgttattggc

22921 cattaaatga ttatggtttt tacaccacta ctggcattgg ctaccaacct tacagagttg

22981 tagtactttc ttttgaactt ttaaatgcac cggccacggt ttgtggacca aaattatcca

23041 ctgaccttat taagaaccag tgtgtcaatt ttaattttaa tggactcact ggtactggtg

23101 tgttaactcc ttcttcaaag agatttcaac catttcaaca atttggccgt gatgtttctg

23161 atttcactga ttccgttcga gatcctaaaa catctgaaat attagacatt tcaccttgct

23221 cttttggggg tgtaagtgta attacacctg gaacaaatgc ttcatctgaa gttgctgttc

23281 tatatcaaga tgttaactgc actgatgttt ctacagcaat tcatgcagat caactcacac

23341 cagcttggcg catatattct actggaaaca atgtattcca gactcaagca ggctgtctta

23401 taggagctga gcatgtcgac acttcttatg agtgcgacat tcctattgga gctggcattt

23461 gtgctagtta ccatacagtt tctttattac gtagtactag ccaaaaatct attgtggctt

23521 atactatgtc tttaggtgct gatagttcaa ttgcttactc taataacacc attgctatac

23581 ctactaactt ttcaattagc attactacag aagtaatgcc tgtttctatg gctaaaacct

23641 ccgtagattg taatatgtac atctgcggag attctactga atgtgctaat ttgcttctcc

23701 aatatggtag cttttgcaca caactaaatc gtgcactctc aggtattgct gctgaacagg

23761 atcgcaacac acgtgaagtg ttcgctcaag tcaaacaaat gtacaaaacc ccaactttga

23821 aatattttgg tggttttaat ttttcacaaa tattacctga ccctctaaag ccaactaaga

23881 ggtcttttat tgaggacttg ctctttaata aggtgacact cgctgatgct ggcttcatga

23941 agcaatatgg cgaatgccta ggtgatatta atgctagaga tctcatttgt gcgcagaagt

24001 tcaatggact tacagtgttg ccacctctgc tcactgatga tatgattgct gcctacactg

24061 ctgctctagt tagtggtact gccactgctg gatggacatt tggtgctggc gctgctcttc

24121 aaataccttt tgctatgcaa atggcatata ggttcaatgg cattggagtt acccaaaatg

24181 ttctctatga gaaccaaaaa caaatcgcca accaatttaa caaggcgatt agtcaaattc

24241 aagaatcact tacaacaaca tcaactgcat tgggcaagct gcaagacgtt gttaaccaga

24301 atgctcaagc attaaacaca cttgttaaac aacttagctc taattttggt gcaatttcaa

24361 gtgtgctaaa tgatatcctt tcgcgacttg ataaagtcga ggcggaggta caaattgaca

24421 ggttaattac aggcagactt caaagccttc aaacctatgt aacacaacaa ctaatcaggg

24481 ctgctgaaat cagggcttct gctaatcttg ctgctactaa aatgtctgag tgtgttcttg

24541 gacaatcaaa aagagttgac ttttgtggaa agggctacca ccttatgtcc ttcccacaag

24601 cagccccgca tggtgttgtc ttcctacatg tcacgtatgt gccatcccag gagaggaact

24661 tcaccacagc gccagcaatt tgtcatgaag gcaaagcata cttccctcgt gaaggtgttt

24721 ttgtgtttaa tggcacttct tggtttatta cacagaggaa cttcttttct ccacaaataa

24781 ttactacaga caatacattt gtctcaggaa attgtgatgt cgttattggc atcattaaca

24841 acacagttta tgatcctctg caacctgagc tcgactcatt caaagaagag ctggacaagt

24901 acttcaaaaa tcatacatca ccagatgttg atcttggcga catttcaggc attaacgctt

24961 ctgtcgtcaa cattcaaaaa gaaattgacc gcctcaatga ggtcgctaaa aatttaaatg

25021 aatcactcat tgaccttcaa gaattgggaa aatatgagca atatattaaa tggccttggt

25081 atgtttggct cggcttcatt gctggactaa ttgccatcgt catggttaca atcttgcttt

25141 gttgcatgac tagttgttgc agttgcctca agggtgcatg ctcttgtggt tcttgctgca

25201 agtttgatga ggatgactct gagccagttc tcaagggtgt caaattacat tacacataaa

25261 cgaacttatg gatttgttta tgagattttt tactcttgga tcaattactg cacagccagt

25321 aaaaattgac aatgcttctc ctgcaagtac tgttcatgct acagcaacga taccgctaca

25381 agcctcactc cctttcggat ggcttgttat tggcgttgca tttcttgctg tttttcagag

25441 cgctaccaaa ataattgcgc tcaataaaag atggcagcta gccctttata agggcttcca

25501 gttcatttgc aatttactgc tgctatttgt taccatctat tcacatcttt tgcttgtcgc

25561 tgcaggtatg gaggcgcaat ttttgtacct ctatgccttg atatattttc tacaatgcat

25621 caacgcatgt agaattatta tgagatgttg gctttgttgg aagtgcaaat ccaagaaccc

25681 attactttat gatgccaact actttgtttg ctggcacaca cataactatg actactgtat

25741 accatataac agtgtcacag atacaattgt cgttactgaa ggtgacggca tttcaacacc

25801 aaaactcaaa gaagactacc aaattggtgg ttattctgag gataggcact caggtgttaa

25861 agactatgtc gttgtacatg gctatttcac cgaagtttac taccagcttg agtctacaca

25921 aattactaca gacactggta ttgaaaatgc tacattcttc atctttaaca agcttgttaa

25981 agacccaccg aatgtgcaaa tacacacaat cgacggctct tcaggagttg ctaatccagc

26041 aatggatcca atttatgatg agccgacgac gactactagc gtgcctttgt aagcacaaga

26101 aagtgagtac gaacttatgt actcattcgt ttcggaagaa acaggtacgt taatagttaa

26161 tagcgtactt ctttttcttg ctttcgtggt attcttgcta gtcacactag ccatccttac

26221 tgcgcttcga ttgtgtgcgt actgctgcaa tattgttaac gtgagtttag taaaaccaac

26281 ggtttacgtc tactcgcgtg ttaaaaatct gaactcttct gaaggagttc ctgatcttct

26341 ggtctaaacg aactaactat tattattatt ctgtttggaa ctttaacatt gcttatcatg

26401 gcagacaacg gtactattac cgttgaggag cttaaacaac tcctggaaca atggaaccta

26461 gtaataggtt tcctattcct agcctggatt atgttactac aatttgccta ttctaatcgg

26521 aacaggtttt tgtacataat aaagcttgtt ttcctctggc tcttgtggcc agtaacactt

26581 gcttgttttg tgcttgctgc tgtctacaga attaattggg tgactggcgg gattgcgatt

26641 gcaatggctt gtattgtagg cttgatgtgg cttagctact tcgttgcttc cttcaggctg

26701 tttgctcgta cccgctcaat gtggtcattc aacccagaaa caaacattct tctcaatgtg

26761 cctctccggg ggacaattgt gaccagaccg ctcatggaaa gtgaacttgt cattggtgct

26821 gtgatcattc gtggtcactt gcgaatggcc ggacaccccc tagggcgctg tgacattaag

26881 gacctgccaa aagagatcac tgtggctaca tcacgaacgc tttcttatta caaattagga

26941 gcgtcgcagc gtgtaggcac tgattcaggt tttgctgcat acaaccgcta ccgtattgga

27001 aactataaat taaatacaga ccacgccggt agcaacgaca atattgcttt gctagtacag

27061 taagtgacaa cagatgtttc atcttgttga cttccaggtt acaatagcag agatattgat

27121 tatcattatg aggactttca ggattgctat ttggaatctt gacgttataa taagttcaat

27181 agtgagacaa ttatttaagc ctctaactaa gaagaattat tcggagttag atgatgaaga

27241 acctatggag ttagattatc cataaaacga acatgaaaat tattctcttc ctgacattga

27301 ttgtatttac atcttgcgag ctatatcact atcaggagtg tgttagaggt acgactgtac

27361 tactaaaaga accttgccca tcaggaacat acgagggcaa ttcaccattt caccctcttg

27421 ctgacaataa atttgcacta acttgcacta gcacacactt tgcttttgct tgtgctgacg

27481 gtactcgaca tacctatcag ctgcgtgcaa gatcagtttc accaaaactt ttcatcagac

27541 aagaggaggt tcaacaagag ctctactcgc cactttttct cattgttgct gctctagtat

27601 ttttaatact ttgcttcacc attaagagaa agacagaatg aatgagctca ctttaattga

27661 cttctatttg tgctttttag cctttctgct attccttgtt ttaataatgc ttattatatt

27721 ttggttttca ctcgaaatcc aggatctaga agaaccttgt accaaagtct aaacgaacat

27781 gaaacttctc attgttttga cttgtatttc tctatgcagt tgcatatgca ctgtagtaca

27841 gcgctgtgca tctaataaac ctcatgtgct tgaagatcct tgtaaggtac aacactaggg

27901 gtaatactta tagcactgct tggctttgtg ctctaggaaa ggttttacct tttcatagat

27961 ggcacactat ggttcaaaca tgcacaccta atgttactat caactgtcaa gatccagctg

28021 gtggtgcgct tatagctagg tgttggtacc ttcatgaagg tcaccaaact gctgcattta

28081 gagacgtact tgttgtttta aataaacgaa caaattaaaa tgtctgataa tggaccccaa

28141 tcaaaccaac gtagtgcccc ccgcattaca tttggtggac ccacagattc aactgacaat

28201 aaccagaatg gaggacgcaa tggggcaagg ccaaaacagc gccgacccca aggtttaccc

28261 aataatactg cgtcttggtt cacagctctc actcagcatg gcaaggagga acttagattc

28321 cctcgaggcc agggcgttcc aatcaacacc aatagtggtc cagatgacca aattggctac

28381 taccgaagag ctacccgacg agttcgtggt ggtgacggca aaatgaaaga gctcagcccc

28441 agatggtact tctattacct aggaactggc ccagaagctt cacttcccta cggcgctaac

28501 aaagaaggca tcgtatgggt tgcaactgag ggagccttga atacacccaa agaccacatt

28561 ggcacccgca atcctaataa caatgctgcc accgtgctac aacttcctca aggaacaaca

28621 ttgccaaaag gcttctacgc agagggaagc agaggcggca gtcaagcctc ttctcgctcc

28681 tcatcacgta gtcgcggtaa ttcaagaaat tcaactcctg gcagcagtag gggaaattct

28741 cctgctcgaa tggctagcgg aggtggtgaa actgccctcg cgctattgct gctagacaga

28801 ttgaaccagc ttgagagcaa agtttctggt aaaggccaac aacaacaagg ccaaactgtc

28861 actaagaaat ctgctgctga ggcatctaaa aagcctcgcc aaaaacgtac tgccacaaaa

28921 cagtacaacg tcactcaagc atttgggaga cgtggtccag aacaaaccca aggaaatttc

28981 ggggaccaag acctaatcag acaaggaact gattacaaac attggccgca aattgcacaa

29041 tttgctccaa gtgcctctgc attctttgga atgtcacgca ttggcatgga agtcacacct

29101 tcgggaacat ggctgactta tcatggagcc attaaattgg atgacaaaga tccacaattc

29161 aaagacaacg tcatactgct gaacaagcac attgacgcat acaaaacatt cccaccaaca

29221 gagcctaaaa aggacaaaaa gaaaaagact gatgaagctc agcctttgcc gcagagacaa

29281 aagaagcagc ccactgtgac tcttcttcct gcggctgaca tggatgattt ctccagacaa

29341 cttcaaaatt ccatgagtgg agcttctgct gattcaactc aggcataaac actcatgatg

29401 accacacaag gcagatgggc tatgtaaacg ttttcgcaat tccgtttacg atacatagtc

29461 tactcttgtg cagaatgaat tctcgtaact aaacagcaca agtaggttta gttaacttta

29521 atctcacata gcaatcttta atcaatgtgt aacattaggg aggacttgaa agagccacca

29581 cattttcatc gaggccacgc ggagtacgat cgagggtaca gtgaataatg ctagggagag

29641 ctgcctatat ggaagagccc taatgtgtaa aattaatttt agtagtgcta tccccatgtg

29701 attttaatag cttcttagga gaatgac

ΠΗΓΗ:SARS coronavirus Urbani, complete genome – CDC

https://www.cdc.gov › lab › downloads › nucleoseq
PDF
από SS Monroe2003Γίνεται αναφορά σε 3 — DEFINITION SARS coronavirus Urbani, complete genome. … CONSRTM CDC SARS Coronavirus Sequencing Team … /note=”surface spike glycoprotein”. /codon_start=1.
Ομοίως όρα Dr Δημήτρη Αντωνίου COVID-19 Tα Αυθεντικά Πειράματα Κατασξευής του, Έκδοση Κελλιωτών Πατέρων Άγιον Όρος 2021, σελ.123. (Πρόκειται για το γονιδίωμα της αρχικής χιμαίρας SHCO14-spike που παρήχθη στο εργαστήριο της Wuhan από αυτή ξεκίνησε ο Sars-Cov-2 της Πανδημίας)

1 σχόλιο

  1. Κατά τη γνώμη μου η διεμφυλικοτητα
    Είναι πράγματι διαταραχή αλλά όχι μυαλού αλλά διαταραχή γονιδιων… Τα γονίδια είναι αυτά που καθορίζουν την προσωπικότητα μας… Κι όχι το μυαλό μας… Ή η ψυχολογία μας..

Αφήστε μια απάντηση

Η διεύθυνση του email σας δεν θα δημοσιευθεί.